Lineage for d1xgma1 (1xgm A:195-271)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351963Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. 351964Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 351965Species Archaeon Pyrococcus furiosus [TaxId:2261] [46889] (4 PDB entries)
  8. 351970Domain d1xgma1: 1xgm A:195-271 [16220]
    Other proteins in same PDB: d1xgma2, d1xgmb2

Details for d1xgma1

PDB Entry: 1xgm (more details), 2.8 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgma1 a.4.5.25 (A:195-271) Methionine aminopeptidase, insert domain {Archaeon Pyrococcus furiosus}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

SCOP Domain Coordinates for d1xgma1:

Click to download the PDB-style file with coordinates for d1xgma1.
(The format of our PDB-style files is described here.)

Timeline for d1xgma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgma2