Lineage for d1xgma1 (1xgm A:195-271)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [46889] (5 PDB entries)
  8. Domain d1xgma1: 1xgm A:195-271 [16220]
    Other proteins in same PDB: d1xgma2, d1xgmb2
    complexed with co

Details for d1xgma1

PDB Entry: 1xgm (more details), 2.8 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1xgma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgma1 a.4.5.25 (A:195-271) Methionine aminopeptidase, insert domain {Pyrococcus furiosus [TaxId: 2261]}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

SCOPe Domain Coordinates for d1xgma1 are not available.

Timeline for d1xgma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgma2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xgmb1, d1xgmb2