Lineage for d1ygzf_ (1ygz F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2060658Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2060813Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2060814Protein automated matches [190523] (11 species)
    not a true protein
  7. 2060847Species Helicobacter pylori [TaxId:85962] [187481] (3 PDB entries)
  8. 2060855Domain d1ygzf_: 1ygz F: [162198]
    automated match to d1qeza_

Details for d1ygzf_

PDB Entry: 1ygz (more details), 2.6 Å

PDB Description: Crystal Structure of Inorganic Pyrophosphatase from Helicobacter pylori
PDB Compounds: (F:) inorganic pyrophosphatase

SCOPe Domain Sequences for d1ygzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygzf_ b.40.5.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]}
mnleklevshdadslcvvieiskhsnikyeldkesgalmvdrvlygaqnypanygfvpnt
lgsdgdpvdalvlsdvafqagsvvkarlvgvlnmedesgmdeklialpidkidpthsyvk
diddlskhtldkikhffetykdlepnkwvkvkgfenkesaikvlekaikayq

SCOPe Domain Coordinates for d1ygzf_:

Click to download the PDB-style file with coordinates for d1ygzf_.
(The format of our PDB-style files is described here.)

Timeline for d1ygzf_: