SCOPe 2.08: Domain d1xgnb1: 1xgn B:195-271

Lineage for d1xgnb1 (1xgn B:195-271)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
   circularly permuted version of the "winged helix" fold

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Pyrococcus furiosus [TaxId:2261] [46889] (5 PDB entries)

8. Domain d1xgnb1: 1xgn B:195-271 [16219]
   Other proteins in same PDB: d1xgna2, d1xgnb2
   complexed with co

Details for d1xgnb1

PDB Entry: 1xgn, 2.9 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

PDB Compounds: (B:) Methionine aminopeptidase

SCOPe Domain Sequences for d1xgnb1:

Sequence; same for both SEQRES and ATOM records:

>d1xgnb1 a.4.5.25 (B:195-271) Methionine aminopeptidase, insert domain {Pyrococcus furiosus [TaxId: 2261]}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

Timeline for d1xgnb1:

• d1xgnb1 first appeared (with stable ids) in SCOP 1.55
  
• d1xgnb1 appears in SCOPe 2.07