SCOPe 2.06: Domain d1ye6a_: 1ye6 A:

Lineage for d1ye6a_ (1ye6 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Xylose reductase [75058] (1 species)

7. Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries)
   Uniprot O74237

8. Domain d1ye6a_: 1ye6 A: [162185]
   automated match to d1jeza_
   complexed with nad, nap, so4; mutant

Details for d1ye6a_

PDB Entry: 1ye6, 2.3 Å

PDB Description: crystal structure of the lys-274 to arg mutant of candida tenuis xylose reductase (akr2b5) bound to nadp+

PDB Compounds: (A:) NAD(P)H-dependent D-xylose reductase

SCOPe Domain Sequences for d1ye6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ye6a_ c.1.7.1 (A:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

Timeline for d1ye6a_:

• d1ye6a_ first appeared in SCOPe 2.01
  
• d1ye6a_ appears in SCOPe 2.05
  
• d1ye6a_ appears in SCOPe 2.07
  
• d1ye6a_ appears in the current release, SCOPe 2.08