Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein Xylose reductase [75058] (1 species) |
Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries) Uniprot O74237 |
Domain d1ye6a_: 1ye6 A: [162185] automated match to d1jeza_ complexed with nad, nap, so4; mutant |
PDB Entry: 1ye6 (more details), 2.3 Å
SCOPe Domain Sequences for d1ye6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ye6a_ c.1.7.1 (A:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]} sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd tikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeeiakl diglrfndpwdwdnipifv
Timeline for d1ye6a_: