Lineage for d1xgna1 (1xgn A:195-271)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1667Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
  6. 1668Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 1674Species Pyrococcus furiosus [TaxId:186497] [46889] (4 PDB entries)
  8. 1677Domain d1xgna1: 1xgn A:195-271 [16218]
    Other proteins in same PDB: d1xgna2, d1xgnb2

Details for d1xgna1

PDB Entry: 1xgn (more details), 2.9 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgna1 a.4.5.25 (A:195-271) Methionine aminopeptidase, insert domain {Pyrococcus furiosus}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

SCOP Domain Coordinates for d1xgna1:

Click to download the PDB-style file with coordinates for d1xgna1.
(The format of our PDB-style files is described here.)

Timeline for d1xgna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgna2