Lineage for d1xgna1 (1xgn A:195-271)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693678Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. 2693679Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 2693699Species Pyrococcus furiosus [TaxId:2261] [46889] (5 PDB entries)
  8. 2693704Domain d1xgna1: 1xgn A:195-271 [16218]
    Other proteins in same PDB: d1xgna2, d1xgnb2
    complexed with co

Details for d1xgna1

PDB Entry: 1xgn (more details), 2.9 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1xgna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgna1 a.4.5.25 (A:195-271) Methionine aminopeptidase, insert domain {Pyrococcus furiosus [TaxId: 2261]}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

SCOPe Domain Coordinates for d1xgna1:

Click to download the PDB-style file with coordinates for d1xgna1.
(The format of our PDB-style files is described here.)

Timeline for d1xgna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgna2