SCOPe 2.08: Domain d1yc7b1: 1yc7 B:2-117

Lineage for d1yc7b1 (1yc7 B:2-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d1yc7b1: 1yc7 B:2-117 [162179]
   Other proteins in same PDB: d1yc7a2, d1yc7b2
   automated match to d1op9a_
   complexed with so4

Details for d1yc7b1

PDB Entry: 1yc7, 1.6 Å

PDB Description: cAbAn33 VHH fragment against VSG

PDB Compounds: (B:) anti-VSG immunoglobulin heavy chain variable domain cAbAn33

SCOPe Domain Sequences for d1yc7b1:

Sequence, based on SEQRES records:

>d1yc7b1 b.1.1.1 (B:2-117) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgstyspcttgwyrqapgkerewvssisspgtiyyqd
svkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvs

Sequence, based on observed residues (ATOM records):

>d1yc7b1 b.1.1.1 (B:2-117) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgtyspcttgwyrqapgkerewvssisspgtiyyqds
vkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvs

Timeline for d1yc7b1:

• d1yc7b1 first appeared in SCOPe 2.01, called d1yc7b_
  
• d1yc7b1 appears in SCOPe 2.07