Lineage for d1yc7a1 (1yc7 A:2-116)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347169Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2347176Domain d1yc7a1: 1yc7 A:2-116 [162178]
    Other proteins in same PDB: d1yc7a2, d1yc7b2
    automated match to d1op9a_
    complexed with so4

Details for d1yc7a1

PDB Entry: 1yc7 (more details), 1.6 Å

PDB Description: cAbAn33 VHH fragment against VSG
PDB Compounds: (A:) anti-VSG immunoglobulin heavy chain variable domain cAbAn33

SCOPe Domain Sequences for d1yc7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yc7a1 b.1.1.1 (A:2-116) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgstyspcttgwyrqapgkerewvssisspgtiyyqd
svkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtv

SCOPe Domain Coordinates for d1yc7a1:

Click to download the PDB-style file with coordinates for d1yc7a1.
(The format of our PDB-style files is described here.)

Timeline for d1yc7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yc7a2