SCOPe 2.08: Domain d1yc0i1: 1yc0 I:245-303

Lineage for d1yc0i1 (1yc0 I:245-303)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188132] (10 PDB entries)

8. Domain d1yc0i1: 1yc0 I:245-303 [162177]
   Other proteins in same PDB: d1yc0a_, d1yc0i2
   automated match to d1aapa_
   complexed with po4

Details for d1yc0i1

PDB Entry: 1yc0, 2.6 Å

PDB Description: short form HGFA with first Kunitz domain from HAI-1

PDB Compounds: (I:) Kunitz-type protease inhibitor 1

SCOPe Domain Sequences for d1yc0i1:

Sequence; same for both SEQRES and ATOM records:

>d1yc0i1 g.8.1.0 (I:245-303) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtedyclasnkvgrcrgsfprwyydpteqicksfvyggclgnknnylreeecilacrgv

Timeline for d1yc0i1:

• d1yc0i1 first appeared in SCOPe 2.01, called d1yc0i_
  
• d1yc0i1 appears in SCOPe 2.07