Lineage for d1y9zb_ (1y9z B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873644Protein automated matches [190073] (16 species)
    not a true protein
  7. 2873774Species Pseudoalteromonas sp. [TaxId:247492] [188095] (2 PDB entries)
  8. 2873776Domain d1y9zb_: 1y9z B: [162173]
    automated match to d1v6cb_
    complexed with ca, na, pms, so4, trs

Details for d1y9zb_

PDB Entry: 1y9z (more details), 1.4 Å

PDB Description: Crystal Structure of Psychrophilic Subtilisin-like Serine Protease from Antarctic Psychrotroph Pseudoalteromonas sp. AS-11 at 0.14 nm resolution
PDB Compounds: (B:) Alkaline serine protease

SCOPe Domain Sequences for d1y9zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9zb_ c.41.1.1 (B:) automated matches {Pseudoalteromonas sp. [TaxId: 247492]}
aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
avaakayldesctgpt

SCOPe Domain Coordinates for d1y9zb_:

Click to download the PDB-style file with coordinates for d1y9zb_.
(The format of our PDB-style files is described here.)

Timeline for d1y9zb_: