Lineage for d1y9rb_ (1y9r B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009513Domain d1y9rb_: 1y9r B: [162171]
    automated match to d1m2za_
    complexed with 1ca; mutant

Details for d1y9rb_

PDB Entry: 1y9r (more details), 1.96 Å

PDB Description: Crystal structure of the human mineralocorticoid receptor ligand-binding domain bound to deoxycorticosterone and harboring the S810L mutation responsible for a severe form of hypertension
PDB Compounds: (B:) Mineralocorticoid receptor

SCOPe Domain Sequences for d1y9rb_:

Sequence, based on SEQRES records: (download)

>d1y9rb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkapnnsgq
swqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgna
kplyfhrk

Sequence, based on observed residues (ATOM records): (download)

>d1y9rb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtqrfyqltk
lldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfhrk

SCOPe Domain Coordinates for d1y9rb_:

Click to download the PDB-style file with coordinates for d1y9rb_.
(The format of our PDB-style files is described here.)

Timeline for d1y9rb_: