Lineage for d1y9ra_ (1y9r A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein automated matches [190059] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187214] (165 PDB entries)
  8. Domain d1y9ra_: 1y9r A: [162170]
    automated match to d1m2za_
    complexed with 1ca; mutant

Details for d1y9ra_

PDB Entry: 1y9r (more details), 1.96 Å

PDB Description: Crystal structure of the human mineralocorticoid receptor ligand-binding domain bound to deoxycorticosterone and harboring the S810L mutation responsible for a severe form of hypertension
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d1y9ra_:

Sequence, based on SEQRES records: (download)

>d1y9ra_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkapnnsgq
swqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgna
kplyfhr

Sequence, based on observed residues (ATOM records): (download)

>d1y9ra_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmcllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtswqrfyql
tklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfhr

SCOPe Domain Coordinates for d1y9ra_ are not available.

Timeline for d1y9ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y9rb_