| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein) circularly permuted version of the "winged helix" fold |
| Protein Methionine aminopeptidase, insert domain [46888] (2 species) |
| Species Archaeon Pyrococcus furiosus [TaxId:2261] [46889] (4 PDB entries) |
| Domain d1xgsb1: 1xgs B:195-271 [16217] Other proteins in same PDB: d1xgsa2, d1xgsb2 complexed with co |
PDB Entry: 1xgs (more details), 1.75 Å
SCOP Domain Sequences for d1xgsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgsb1 a.4.5.25 (B:195-271) Methionine aminopeptidase, insert domain {Archaeon Pyrococcus furiosus}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei
Timeline for d1xgsb1: