SCOPe 2.06: Domain d1y75b_: 1y75 B:

Lineage for d1y75b_ (1y75 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Naja sagittifera [TaxId:195058] [188129] (2 PDB entries)

8. Domain d1y75b_: 1y75 B: [162167]
   automated match to d1owsb_
   complexed with nag, zn

Details for d1y75b_

PDB Entry: 1y75, 2.3 Å

PDB Description: a new form of catalytically inactive phospholipase a2 with an unusual disulphide bridge cys 32- cys 49 reveals recognition for n- acetylglucosmine

PDB Compounds: (B:) phospholipase A2 isoform 6

SCOPe Domain Sequences for d1y75b_:

Sequence; same for both SEQRES and ATOM records:

>d1y75b_ a.133.1.2 (B:) automated matches {Naja sagittifera [TaxId: 195058]}
nikqfnnmiqctvparswwdfadygcycgsgsgspvddldrccqvhdncynagggvtgca
pksktytyecsqgtltcsgensacaatvcdcdrlaaicfagapyndnnynidlksrcq

Timeline for d1y75b_:

• d1y75b_ first appeared in SCOPe 2.01
  
• d1y75b_ appears in SCOPe 2.05
  
• d1y75b_ appears in SCOPe 2.07
  
• d1y75b_ appears in the current release, SCOPe 2.08