Class a: All alpha proteins [46456] (289 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein automated matches [190139] (26 species) not a true protein |
Species Naja sagittifera [TaxId:195058] [188129] (2 PDB entries) |
Domain d1y75b_: 1y75 B: [162167] automated match to d1owsb_ complexed with nag, zn |
PDB Entry: 1y75 (more details), 2.3 Å
SCOPe Domain Sequences for d1y75b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y75b_ a.133.1.2 (B:) automated matches {Naja sagittifera [TaxId: 195058]} nikqfnnmiqctvparswwdfadygcycgsgsgspvddldrccqvhdncynagggvtgca pksktytyecsqgtltcsgensacaatvcdcdrlaaicfagapyndnnynidlksrcq
Timeline for d1y75b_: