Lineage for d1y75a_ (1y75 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733463Species Naja sagittifera [TaxId:195058] [188129] (2 PDB entries)
  8. 2733465Domain d1y75a_: 1y75 A: [162166]
    automated match to d1owsa_
    complexed with nag, zn

Details for d1y75a_

PDB Entry: 1y75 (more details), 2.3 Å

PDB Description: a new form of catalytically inactive phospholipase a2 with an unusual disulphide bridge cys 32- cys 49 reveals recognition for n- acetylglucosmine
PDB Compounds: (A:) phospholipase A2 isoform 5

SCOPe Domain Sequences for d1y75a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y75a_ a.133.1.2 (A:) automated matches {Naja sagittifera [TaxId: 195058]}
ntyqfrnmiqctvpsrswwdfadygcycgcgsgtpvddldrccqvhcncyrqageisgcr
pkfktytyecsggtltckgdnnacaasscdcdrlaaicfagapyndnnynidlkarcn

SCOPe Domain Coordinates for d1y75a_:

Click to download the PDB-style file with coordinates for d1y75a_.
(The format of our PDB-style files is described here.)

Timeline for d1y75a_: