Lineage for d1y6za_ (1y6z A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2158083Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2158084Protein automated matches [190826] (17 species)
    not a true protein
  7. 2158186Species Plasmodium falciparum [TaxId:36329] [188127] (1 PDB entry)
  8. 2158187Domain d1y6za_: 1y6z A: [162164]
    automated match to d1usua_

Details for d1y6za_

PDB Entry: 1y6z (more details), 1.88 Å

PDB Description: Middle domain of Plasmodium falciparum putative heat shock protein PF14_0417
PDB Compounds: (A:) heat shock protein, putative

SCOPe Domain Sequences for d1y6za_:

Sequence, based on SEQRES records: (download)

>d1y6za_ d.14.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
piwkqdeksltendyysfykntfkayddplayvhfnvegqisfnsilyipgslpwelskn
mfdeesrgirlyvkrvfindkfsesiprwltflrgivdsenlplnvgreilqkskmlsii
nkrivlksismmkglketggdkwtkflntfgkylkigvvedkenqeeiaslvefysinsg
dkktdldsyienmkedqkciyyisgenkktaqnspsleklkalnydvlfslepidefcls
sltvnkykgyevldvnka

Sequence, based on observed residues (ATOM records): (download)

>d1y6za_ d.14.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
piwkqdeksltendyysfykntfkayddplayvhfnvegqisfnsilyipgslpwelskn
mfrgirlyvkrvfindkfsesiprwltflrgivdsenskmlsiinkrivlksismmkglk
etggdkwtkflntfgkylkigvvedkenqeeiaslvefysinsgdkktdldsyienmked
qkciyyisgenkktaqnspsleklkalnydvlfslepidefclssltvnkykgyevldvn
ka

SCOPe Domain Coordinates for d1y6za_:

Click to download the PDB-style file with coordinates for d1y6za_.
(The format of our PDB-style files is described here.)

Timeline for d1y6za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y6zb_