SCOP 1.75: Domain d1xgsa1: 1xgs A:195-271

Lineage for d1xgsa1 (1xgs A:195-271)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
   circularly permuted version of the "winged helix" fold

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [46889] (4 PDB entries)

8. Domain d1xgsa1: 1xgs A:195-271 [16216]
   Other proteins in same PDB: d1xgsa2, d1xgsb2

Details for d1xgsa1

PDB Entry: 1xgs, 1.75 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d1xgsa1:

Sequence; same for both SEQRES and ATOM records:

>d1xgsa1 a.4.5.25 (A:195-271) Methionine aminopeptidase, insert domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

Timeline for d1xgsa1:

• d1xgsa1 first appeared (with stable ids) in SCOP 1.55
  
• d1xgsa1 appears in SCOP 1.73
  
• d1xgsa1 appears in SCOPe 2.01
  
• d1xgsa1 appears in the current release, SCOPe 2.08