![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
![]() | Protein automated matches [190191] (2 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries) |
![]() | Domain d1y55y1: 1y55 Y:203-321 [162155] Other proteins in same PDB: d1y55x2, d1y55y2 automated match to d1rava_ complexed with btn, fmt; mutant |
PDB Entry: 1y55 (more details), 1 Å
SCOPe Domain Sequences for d1y55y1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y55y1 b.61.1.1 (Y:203-321) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptf gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrl
Timeline for d1y55y1: