SCOPe 2.03: Domain d1y55x_: 1y55 X:

Lineage for d1y55x_ (1y55 X:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (22 PDB entries)

8. Domain d1y55x_: 1y55 X: [162154]
   automated match to d1rava_
   complexed with btn, fmt; mutant

Details for d1y55x_

PDB Entry: 1y55, 1 Å

PDB Description: crystal structure of the c122s mutant of e. coli expressed avidin related protein 4 (avr4)-biotin complex

PDB Compounds: (X:) Avidin-related protein 4/5

SCOPe Domain Sequences for d1y55x_:

Sequence; same for both SEQRES and ATOM records:

>d1y55x_ b.61.1.1 (X:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptf
gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrls

Timeline for d1y55x_:

• d1y55x_ first appeared in SCOPe 2.01
  
• d1y55x_ appears in SCOPe 2.02
  
• d1y55x_ appears in SCOPe 2.04
  
• d1y55x_ appears in the current release, SCOPe 2.08, called d1y55x1