Lineage for d1y54a_ (1y54 A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. Protein automated matches [190161] (29 species)
    not a true protein
  7. Species Enterobacter cloacae [TaxId:550] [187307] (6 PDB entries)
  8. Domain d1y54a_: 1y54 A: [162153]
    automated match to d1gcea_
    complexed with fdt

Details for d1y54a_

PDB Entry: 1y54 (more details), 2.1 Å

PDB Description: crystal structure of the native class c beta-lactamase from enterobacter cloacae 908r complexed with brl42715
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1y54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y54a_ e.3.1.1 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
vsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfel
gsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqvp
devtdnaslvrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkpl
kldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmapen
vadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvvevn
ppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhilealq

SCOPe Domain Coordinates for d1y54a_ are not available.

Timeline for d1y54a_: