SCOPe 2.04: Domain d1y53y_: 1y53 Y:

Lineage for d1y53y_ (1y53 Y:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (24 PDB entries)

8. Domain d1y53y_: 1y53 Y: [162152]
   automated match to d1rava_
   complexed with fmt

Details for d1y53y_

PDB Entry: 1y53, 1.2 Å

PDB Description: crystal structure of bacterial expressed avidin related protein 4 (avr4) c122s

PDB Compounds: (Y:) Avidin-related protein 4/5

SCOPe Domain Sequences for d1y53y_:

Sequence; same for both SEQRES and ATOM records:

>d1y53y_ b.61.1.1 (Y:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptf
gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrls

Timeline for d1y53y_:

• d1y53y_ first appeared in SCOPe 2.01
  
• d1y53y_ appears in SCOPe 2.03
  
• d1y53y_ appears in SCOPe 2.05
  
• d1y53y_ appears in the current release, SCOPe 2.08, called d1y53y1