Lineage for d1b1ba1 (1b1b A:1-64)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45728Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)
  6. 45754Protein Iron-dependent regulator IdeR [46885] (1 species)
  7. 45755Species Mycobacterium tuberculosis [TaxId:1773] [46886] (2 PDB entries)
  8. 45760Domain d1b1ba1: 1b1b A:1-64 [16215]
    Other proteins in same PDB: d1b1ba2

Details for d1b1ba1

PDB Entry: 1b1b (more details), 2.6 Å

PDB Description: iron dependent regulator

SCOP Domain Sequences for d1b1ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1ba1 a.4.5.24 (A:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis}
mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
hlel

SCOP Domain Coordinates for d1b1ba1:

Click to download the PDB-style file with coordinates for d1b1ba1.
(The format of our PDB-style files is described here.)

Timeline for d1b1ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b1ba2