| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
| Protein Iron-dependent regulator IdeR [46885] (1 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries) Uniprot Q50495 |
| Domain d1b1ba1: 1b1b A:1-64 [16215] Other proteins in same PDB: d1b1ba2 complexed with so4, zn |
PDB Entry: 1b1b (more details), 2.6 Å
SCOPe Domain Sequences for d1b1ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b1ba1 a.4.5.24 (A:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
hlel
Timeline for d1b1ba1: