SCOPe 2.01: Domain d1y1tf_: 1y1t F:

Lineage for d1y1tf_ (1y1t F:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [117656] (22 PDB entries)
   Uniprot P0A1F6

8. Domain d1y1tf_: 1y1t F: [162145]
   automated match to d1ryza_
   complexed with gol, so4

Details for d1y1tf_

PDB Entry: 1y1t, 1.77 Å

PDB Description: crystal structure of the uridine phosphorylase from salmonella typhimurium at 1.77a resolution

PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d1y1tf_:

Sequence, based on SEQRES records:

>d1y1tf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records):

>d1y1tf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfsmeewqamgvmnyemesatll
tmcasqglragmvagvivnkqteshavkivveaarrll

Timeline for d1y1tf_:

• d1y1tf_ is new in SCOPe 2.01-stable
  
• d1y1tf_ appears in SCOPe 2.02
  
• d1y1tf_ appears in the current release, SCOPe 2.08