SCOPe 2.05: Domain d1y1rd_: 1y1r D:

Lineage for d1y1rd_ (1y1r D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (5 species)

7. Species Salmonella typhimurium [TaxId:90371] [117656] (24 PDB entries)
   Uniprot P0A1F6

8. Domain d1y1rd_: 1y1r D: [162135]
   automated match to d1ryza_
   complexed with anu, po4

Details for d1y1rd_

PDB Entry: 1y1r, 2.11 Å

PDB Description: crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with inhibitor and phosphate ion at 2.11a resolution

PDB Compounds: (D:) Uridine phosphorylase

SCOPe Domain Sequences for d1y1rd_:

Sequence, based on SEQRES records:

>d1y1rd_ c.56.2.1 (D:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records):

>d1y1rd_ c.56.2.1 (D:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtmkqteshavkivveaarrl
l

Timeline for d1y1rd_:

• d1y1rd_ first appeared in SCOPe 2.01
  
• d1y1rd_ appears in SCOPe 2.04
  
• d1y1rd_ appears in SCOPe 2.06
  
• d1y1rd_ appears in the current release, SCOPe 2.08