Lineage for d1c0wc1 (1c0w C:2-64)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1639Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)
  6. 1640Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 1641Species Corynebacterium diphtheriae [TaxId:1717] [46884] (10 PDB entries)
  8. 1662Domain d1c0wc1: 1c0w C:2-64 [16213]
    Other proteins in same PDB: d1c0wa2, d1c0wa3, d1c0wb2, d1c0wb3, d1c0wc2, d1c0wc3, d1c0wd2, d1c0wd3

Details for d1c0wc1

PDB Entry: 1c0w (more details), 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0wc1 a.4.5.24 (C:2-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
lqm

SCOP Domain Coordinates for d1c0wc1:

Click to download the PDB-style file with coordinates for d1c0wc1.
(The format of our PDB-style files is described here.)

Timeline for d1c0wc1: