![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Bothrops moojeni [TaxId:98334] [188126] (13 PDB entries) |
![]() | Domain d1xxsa_: 1xxs A: [162122] automated match to d1clpa_ complexed with so4, ste |
PDB Entry: 1xxs (more details), 1.8 Å
SCOPe Domain Sequences for d1xxsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxsa_ a.133.1.2 (A:) automated matches {Bothrops moojeni [TaxId: 98334]} slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpackkad pc
Timeline for d1xxsa_: