Lineage for d1xxmd_ (1xxm D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920207Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 1920208Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) (S)
  5. 1920209Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
    automatically mapped to Pfam PF07467
  6. 1920216Protein automated matches [190210] (1 species)
    not a true protein
  7. 1920217Species Streptomyces clavuligerus [TaxId:1901] [188443] (12 PDB entries)
  8. 1920229Domain d1xxmd_: 1xxm D: [162121]
    Other proteins in same PDB: d1xxma_, d1xxmb_
    automated match to d1s0wc_
    complexed with ca

Details for d1xxmd_

PDB Entry: 1xxm (more details), 1.9 Å

PDB Description: the modular architecture of protein-protein binding site
PDB Compounds: (D:) Beta-lactamase inhibitory protein

SCOPe Domain Sequences for d1xxmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxmd_ d.98.1.1 (D:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqeallapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgaargsahlwftdgvlqgkrqwdlv

SCOPe Domain Coordinates for d1xxmd_:

Click to download the PDB-style file with coordinates for d1xxmd_.
(The format of our PDB-style files is described here.)

Timeline for d1xxmd_: