SCOPe 2.06: Domain d1xxmc_: 1xxm C:

Lineage for d1xxmc_ (1xxm C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families)

5. Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold
   automatically mapped to Pfam PF07467

6. Protein automated matches [190210] (1 species)
   not a true protein

7. Species Streptomyces clavuligerus [TaxId:1901] [188443] (12 PDB entries)

8. Domain d1xxmc_: 1xxm C: [162120]
   Other proteins in same PDB: d1xxma_, d1xxmb_
   automated match to d1s0wc_
   complexed with ca

Details for d1xxmc_

PDB Entry: 1xxm, 1.9 Å

PDB Description: the modular architecture of protein-protein binding site

PDB Compounds: (C:) Beta-lactamase inhibitory protein

SCOPe Domain Sequences for d1xxmc_:

Sequence; same for both SEQRES and ATOM records:

>d1xxmc_ d.98.1.1 (C:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqeallapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgaargsahlwftdgvlqgkrqwdlv

Timeline for d1xxmc_:

• d1xxmc_ first appeared in SCOPe 2.01
  
• d1xxmc_ appears in SCOPe 2.05
  
• d1xxmc_ appears in SCOPe 2.07
  
• d1xxmc_ appears in the current release, SCOPe 2.08