Lineage for d1xxmb_ (1xxm B:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450242Protein beta-Lactamase, class A [56606] (16 species)
  7. 1450267Species Escherichia coli, TEM-1 [TaxId:562] [56607] (36 PDB entries)
  8. 1450300Domain d1xxmb_: 1xxm B: [162119]
    Other proteins in same PDB: d1xxmc_, d1xxmd_
    automated match to d1axba_
    complexed with ca

Details for d1xxmb_

PDB Entry: 1xxm (more details), 1.9 Å

PDB Description: the modular architecture of protein-protein binding site
PDB Compounds: (B:) Beta-lactamase TEM

SCOPe Domain Sequences for d1xxmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxmb_ e.3.1.1 (B:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrid
agqeqlgrrihysqndlvaaspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d1xxmb_:

Click to download the PDB-style file with coordinates for d1xxmb_.
(The format of our PDB-style files is described here.)

Timeline for d1xxmb_: