Lineage for d1xwwa_ (1xww A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2482762Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2482763Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2482764Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2482788Protein Tyrosine phosphatase [52790] (5 species)
  7. 2482807Species Human (Homo sapiens) [TaxId:9606] [52792] (13 PDB entries)
  8. 2482811Domain d1xwwa_: 1xww A: [162117]
    automated match to d1bvha_
    complexed with gol, so4

Details for d1xwwa_

PDB Entry: 1xww (more details), 1.63 Å

PDB Description: Crystal Structure of Human B-form Low Molecular Weight Phosphotyrosyl Phosphatase at 1.6 Angstrom Resolution
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d1xwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwwa_ c.44.1.1 (A:) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
aeqatksvlfvclgnicrspiaeavfrklvtdqnisenwvidsgavsdwnvgrspdprav
sclrnhgihtahkarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsyd
pqkqliiedpyygndsdfetvyqqcvrccraflekah

SCOPe Domain Coordinates for d1xwwa_:

Click to download the PDB-style file with coordinates for d1xwwa_.
(The format of our PDB-style files is described here.)

Timeline for d1xwwa_: