Lineage for d1xwoa_ (1xwo A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010373Protein automated matches [190147] (7 species)
    not a true protein
  7. 2010374Species Anser anser [TaxId:8844] [188125] (1 PDB entry)
  8. 2010375Domain d1xwoa_: 1xwo A: [162113]
    automated match to d1k62b_

Details for d1xwoa_

PDB Entry: 1xwo (more details), 2.8 Å

PDB Description: crystal structrue of goose delta crystallin
PDB Compounds: (A:) Delta crystallin

SCOPe Domain Sequences for d1xwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwoa_ a.127.1.1 (A:) automated matches {Anser anser [TaxId: 8844]}
tdpimqmlstsmsteqrlsevdiqasiayakalekagiltktelekilsglekiseewsk
gvfvvtqsdedihtanerrlkeligdiagklntgrsrneqvvtdlklfmknslsvisthl
lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkrrinv
lplgsgalagnpldidremlrseldfasislnsmdaiserdfvveflsvatllmihlskm
aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlstdlaly
lvrkgmpfrqahtasgkavhlaetkgitinnltledlksisplfssdvsqvfnfvnsveq
ytamggtakssvttqiehlrelmkkqke

SCOPe Domain Coordinates for d1xwoa_:

Click to download the PDB-style file with coordinates for d1xwoa_.
(The format of our PDB-style files is described here.)

Timeline for d1xwoa_: