SCOPe 2.08: Domain d1xvjb_: 1xvj B:

Lineage for d1xvjb_ (1xvj B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (3 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Parvalbumin [47495] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [158476] (6 PDB entries)

8. Domain d1xvjb_: 1xvj B: [162112]
   automated match to d1rtp1_
   complexed with ca; mutant

Details for d1xvjb_

PDB Entry: 1xvj, 1.8 Å

PDB Description: crystal structure of rat alpha-parvalbumin d94s/g98e mutant

PDB Compounds: (B:) parvalbumin alpha

SCOPe Domain Sequences for d1xvjb_:

Sequence; same for both SEQRES and ATOM records:

>d1xvjb_ a.39.1.4 (B:) Parvalbumin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgsgkieveefstlvaes

Timeline for d1xvjb_:

• d1xvjb_ first appeared in SCOPe 2.01
  
• d1xvjb_ appears in SCOPe 2.07