Lineage for d1xvja_ (1xvj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710476Family a.39.1.4: Parvalbumin [47492] (3 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 2710482Protein Parvalbumin [47495] (9 species)
  7. 2710507Species Norway rat (Rattus norvegicus) [TaxId:10116] [158476] (6 PDB entries)
  8. 2710513Domain d1xvja_: 1xvj A: [162111]
    automated match to d1rtp1_
    complexed with ca; mutant

Details for d1xvja_

PDB Entry: 1xvj (more details), 1.8 Å

PDB Description: crystal structure of rat alpha-parvalbumin d94s/g98e mutant
PDB Compounds: (A:) parvalbumin alpha

SCOPe Domain Sequences for d1xvja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvja_ a.39.1.4 (A:) Parvalbumin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgsgkieveefstlvaes

SCOPe Domain Coordinates for d1xvja_:

Click to download the PDB-style file with coordinates for d1xvja_.
(The format of our PDB-style files is described here.)

Timeline for d1xvja_: