Lineage for d1xu8b1 (1xu8 B:1-375)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568351Protein automated matches [190484] (2 species)
    not a true protein
  7. 2568352Species Human (Homo sapiens) [TaxId:9606] [188559] (17 PDB entries)
  8. 2568366Domain d1xu8b1: 1xu8 B:1-375 [162110]
    Other proteins in same PDB: d1xu8a2, d1xu8b2
    automated match to d1xqga_
    complexed with so4

Details for d1xu8b1

PDB Entry: 1xu8 (more details), 2.8 Å

PDB Description: The 2.8 A structure of a tumour suppressing serpin
PDB Compounds: (B:) Maspin

SCOPe Domain Sequences for d1xu8b1:

Sequence, based on SEQRES records: (download)

>d1xu8b1 e.1.1.1 (B:1-375) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlhf
envkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletvd
fkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkfpeset
kecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvedes
tglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifsed
tsdfsgmsetkgvalsnvihkvcleitedggdsievpgarilqhkdelnadhpfiyiirh
nktrniiffgkfcsp

Sequence, based on observed residues (ATOM records): (download)

>d1xu8b1 e.1.1.1 (B:1-375) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlhf
envkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletvd
fkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkfpeset
kecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvedes
tglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifsed
tsdfsgmsetkgvalsnvihkvcleitedggdvpgarilqhkdelnadhpfiyiirhnkt
rniiffgkfcsp

SCOPe Domain Coordinates for d1xu8b1:

Click to download the PDB-style file with coordinates for d1xu8b1.
(The format of our PDB-style files is described here.)

Timeline for d1xu8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xu8b2