Lineage for d1xtyd_ (1xty D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1012611Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest
  4. 1012612Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) (S)
  5. 1012632Family c.131.1.0: automated matches [191421] (1 protein)
    not a true family
  6. 1012633Protein automated matches [190592] (3 species)
    not a true protein
  7. 1012644Species Pyrococcus abyssi [TaxId:29292] [188124] (1 PDB entry)
  8. 1012648Domain d1xtyd_: 1xty D: [162108]
    automated match to d1rlka_
    complexed with so4

Details for d1xtyd_

PDB Entry: 1xty (more details), 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase
PDB Compounds: (D:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d1xtyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtyd_ c.131.1.0 (D:) automated matches {Pyrococcus abyssi [TaxId: 29292]}
mikmvivvrsdikmgkgkiaaqvahaavtlvvsiinsnnlrwkewlnewlhqgqpkiivk
vnsldeiisrakkaetmnlpfsiiedagktqlepgtitclgigpapenlvdsitgdlkll

SCOPe Domain Coordinates for d1xtyd_:

Click to download the PDB-style file with coordinates for d1xtyd_.
(The format of our PDB-style files is described here.)

Timeline for d1xtyd_: