Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest |
Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) |
Family c.131.1.0: automated matches [191421] (1 protein) not a true family |
Protein automated matches [190592] (3 species) not a true protein |
Species Pyrococcus abyssi [TaxId:29292] [188124] (1 PDB entry) |
Domain d1xtyd_: 1xty D: [162108] automated match to d1rlka_ complexed with so4 |
PDB Entry: 1xty (more details), 1.8 Å
SCOPe Domain Sequences for d1xtyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtyd_ c.131.1.0 (D:) automated matches {Pyrococcus abyssi [TaxId: 29292]} mikmvivvrsdikmgkgkiaaqvahaavtlvvsiinsnnlrwkewlnewlhqgqpkiivk vnsldeiisrakkaetmnlpfsiiedagktqlepgtitclgigpapenlvdsitgdlkll
Timeline for d1xtyd_: