SCOPe 2.01: Domain d1xssa_: 1xss A:

Lineage for d1xssa_ (1xss A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (7 species)
   not a true protein

7. Species Favia favus [TaxId:102203] [188529] (3 PDB entries)

8. Domain d1xssa_: 1xss A: [162103]
   automated match to d1mova_
   complexed with mg, na

Details for d1xssa_

PDB Entry: 1xss, 1.6 Å

PDB Description: Semi-rational engineering of a green-emitting coral fluorescent protein into an efficient highlighter.

PDB Compounds: (A:) fluorescent protein

SCOPe Domain Sequences for d1xssa_:

Sequence; same for both SEQRES and ATOM records:

>d1xssa_ d.22.1.0 (A:) automated matches {Favia favus [TaxId: 102203]}
vsvitsemkmelrmegavnghkfvitgkgsgqpfegiqnmdltvieggplpfafdilttv
fdygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvye
irfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
kakkvvqlpdyhfvdhrieitshdkdynkvklyehakahsglprla

Timeline for d1xssa_:

• d1xssa_ is new in SCOPe 2.01-stable
  
• d1xssa_ appears in SCOPe 2.02
  
• d1xssa_ appears in the current release, SCOPe 2.08