SCOPe 2.01: Domain d1xrpa_: 1xrp A:

Lineage for d1xrpa_ (1xrp A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins)

6. Protein Tricorn interacting factor F1 [82502] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [82503] (13 PDB entries)

8. Domain d1xrpa_: 1xrp A: [162100]
   automated match to d1mt3a_
   complexed with pro; mutant

Details for d1xrpa_

PDB Entry: 1xrp, 2.3 Å

PDB Description: crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly

PDB Compounds: (A:) proline iminopeptidase

SCOPe Domain Sequences for d1xrpa_:

Sequence; same for both SEQRES and ATOM records:

>d1xrpa_ c.69.1.7 (A:) Tricorn interacting factor F1 {Thermoplasma acidophilum [TaxId: 2303]}
ecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlfydq
fgcgrseepdqskftidygveeaealrsklfgnekvflmgssyggalalayavkyqdhlk
glivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhqhll
rsedwppevlksleyaerrnvyrimngpnqftitgtikdwditdkisaikiptlitvgey
devtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl

Timeline for d1xrpa_:

• d1xrpa_ is new in SCOPe 2.01-stable
  
• d1xrpa_ appears in SCOPe 2.02
  
• d1xrpa_ appears in the current release, SCOPe 2.08