Lineage for d1ddnd1 (1ddn D:3-64)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
automatically mapped to Pfam PF01325
Protein Diphtheria toxin repressor (DtxR) [46883] (1 species) Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
Uniprot P33120
Domain d1ddnd1: 1ddn D:3-64 [16210]
Other proteins in same PDB: d1ddna2, d1ddnb2, d1ddnc2, d1ddnd2
protein/DNA complex; complexed with ni; mutant
Details for d1ddnd1
PDB Entry: 1ddn (more details), 3 Å
PDB Description: diphtheria tox repressor (c102d mutant)/tox dna operator complex
PDB Compounds: (D:) diphtheria tox repressorSCOPe Domain Sequences for d1ddnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddnd1 a.4.5.24 (D:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm
SCOPe Domain Coordinates for d1ddnd1:
Click to download the PDB-style file with coordinates for d1ddnd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ddnd1:
View in 3D
