Lineage for d1xroa_ (1xro A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151220Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins)
  6. 2151229Protein Tricorn interacting factor F1 [82502] (1 species)
  7. 2151230Species Thermoplasma acidophilum [TaxId:2303] [82503] (13 PDB entries)
  8. 2151232Domain d1xroa_: 1xro A: [162099]
    automated match to d1mt3a_
    complexed with leu; mutant

Details for d1xroa_

PDB Entry: 1xro (more details), 1.8 Å

PDB Description: crystal structure of active site f1-mutant e213q soaked with peptide phe-leu
PDB Compounds: (A:) proline iminopeptidase

SCOPe Domain Sequences for d1xroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xroa_ c.69.1.7 (A:) Tricorn interacting factor F1 {Thermoplasma acidophilum [TaxId: 2303]}
ecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlfydq
fgcgrseepdqskftidygveeaealrsklfgnekvflmgssyggalalayavkyqdhlk
glivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhqhll
rsedwppevlksleyaerrnvyrimngpnqftitgtikdwditdkisaikiptlitvgey
devtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl

SCOPe Domain Coordinates for d1xroa_:

Click to download the PDB-style file with coordinates for d1xroa_.
(The format of our PDB-style files is described here.)

Timeline for d1xroa_: