Lineage for d1xrma_ (1xrm A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869621Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins)
  6. 1869630Protein Tricorn interacting factor F1 [82502] (1 species)
  7. 1869631Species Thermoplasma acidophilum [TaxId:2303] [82503] (13 PDB entries)
  8. 1869644Domain d1xrma_: 1xrm A: [162097]
    automated match to d1mt3a_
    complexed with ala, phe; mutant

Details for d1xrma_

PDB Entry: 1xrm (more details), 2.7 Å

PDB Description: crystal structure of active site f1-mutant e213q soaked with peptide ala-phe
PDB Compounds: (A:) proline iminopeptidase

SCOPe Domain Sequences for d1xrma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrma_ c.69.1.7 (A:) Tricorn interacting factor F1 {Thermoplasma acidophilum [TaxId: 2303]}
ecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlfydq
fgcgrseepdqskftidygveeaealrsklfgnekvflmgssyggalalayavkyqdhlk
glivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhqhll
rsedwppevlksleyaerrnvyrimngpnqftitgtikdwditdkisaikiptlitvgey
devtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl

SCOPe Domain Coordinates for d1xrma_:

Click to download the PDB-style file with coordinates for d1xrma_.
(The format of our PDB-style files is described here.)

Timeline for d1xrma_: