Lineage for d1xoib_ (1xoi B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142250Protein automated matches [190111] (3 species)
    not a true protein
  7. 2142260Species Human (Homo sapiens) [TaxId:9606] [186954] (4 PDB entries)
  8. 2142264Domain d1xoib_: 1xoi B: [162092]
    automated match to d1fa9a_
    complexed with 288, nbg, plp

Details for d1xoib_

PDB Entry: 1xoi (more details), 2.1 Å

PDB Description: human liver glycogen phosphorylase a complexed with chloroindoloyl glycine amide
PDB Compounds: (B:) Glycogen phosphorylase, liver form

SCOPe Domain Sequences for d1xoib_:

Sequence, based on SEQRES records: (download)

>d1xoib_ c.87.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgdy
iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrga
atvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpe
alerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinma
hlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglael
iaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssm
fdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiikl
itsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfm
lngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvi
dqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvl
kniaasgkfssdrtikeyaqniwnvepsdlkislsn

Sequence, based on observed residues (ATOM records): (download)

>d1xoib_ c.87.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapyiqavldrnlaen
isrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrgaatvfdafpdqva
iqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvek
llprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavng
vakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkd
lsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheyk
rqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndp
mvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdg
anvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkq
pdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssd
rtikeyaqniwnvepsdlkislsn

SCOPe Domain Coordinates for d1xoib_:

Click to download the PDB-style file with coordinates for d1xoib_.
(The format of our PDB-style files is described here.)

Timeline for d1xoib_: