SCOPe 2.08: Domain d1xmzb1: 1xmz B:2-232

Lineage for d1xmzb1 (1xmz B:2-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Sea anemone (Anemonia sulcata) [TaxId:6108] [188527] (2 PDB entries)

8. Domain d1xmzb1: 1xmz B:2-232 [162090]
   Other proteins in same PDB: d1xmzb2
   automated match to d1xqma_
   complexed with bme, nh2

Details for d1xmzb1

PDB Entry: 1xmz, 1.38 Å

PDB Description: crystal structure of the dark state of kindling fluorescent protein kfp from anemonia sulcata

PDB Compounds: (B:) GFP-like chromoprotein FP595

SCOPe Domain Sequences for d1xmzb1:

Sequence, based on SEQRES records:

>d1xmzb1 d.22.1.1 (B:2-232) automated matches {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
asflkktmpfkttiegtvnghyfkctgkgegnpfegtqemkievieggplpfafhilsts
cmygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvki
lgnnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrsk
kpasalkmpgfhfedhrieimeevekgkcykqyeaavgrycdaapsklghn

Sequence, based on observed residues (ATOM records):

>d1xmzb1 d.22.1.1 (B:2-232) automated matches {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
asflkktmpfkttiegtvnghyfkctgkgegnpfegtqemkievieggplpfafhilsts
cmygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvki
lgnnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrsk
kpasalkmpgfhfedhrieimeevgkcykqyeaavgrycdaapsklghn

Timeline for d1xmzb1:

• d1xmzb1 first appeared in SCOPe 2.01, called d1xmzb_
  
• d1xmzb1 appears in SCOPe 2.07