Lineage for d1xmzb1 (1xmz B:2-232)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. Protein automated matches [190406] (19 species)
    not a true protein
  7. Species Sea anemone (Anemonia sulcata) [TaxId:6108] [188527] (2 PDB entries)
  8. Domain d1xmzb1: 1xmz B:2-232 [162090]
    Other proteins in same PDB: d1xmzb2
    automated match to d1xqma_
    complexed with bme, nh2

Details for d1xmzb1

PDB Entry: 1xmz (more details), 1.38 Å

PDB Description: Crystal structure of the dark state of kindling fluorescent protein kfp from anemonia sulcata
PDB Compounds: (B:) GFP-like chromoprotein FP595

SCOPe Domain Sequences for d1xmzb1:

Sequence, based on SEQRES records: (download)

>d1xmzb1 d.22.1.1 (B:2-232) automated matches {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
asflkktmpfkttiegtvnghyfkctgkgegnpfegtqemkievieggplpfafhilsts
cmygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvki
lgnnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrsk
kpasalkmpgfhfedhrieimeevekgkcykqyeaavgrycdaapsklghn

Sequence, based on observed residues (ATOM records): (download)

>d1xmzb1 d.22.1.1 (B:2-232) automated matches {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
asflkktmpfkttiegtvnghyfkctgkgegnpfegtqemkievieggplpfafhilsts
cmygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvki
lgnnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrsk
kpasalkmpgfhfedhrieimeevgkcykqyeaavgrycdaapsklghn

SCOPe Domain Coordinates for d1xmzb1 are not available.

Timeline for d1xmzb1:

Domains from same chain:
(mouse over for more information)
d1xmzb2
Domains from other chains:
(mouse over for more information)
d1xmza_