Lineage for d1xmza_ (1xmz A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2165015Protein automated matches [190406] (19 species)
    not a true protein
  7. 2165260Species Sea anemone (Anemonia sulcata) [TaxId:6108] [188527] (2 PDB entries)
  8. 2165261Domain d1xmza_: 1xmz A: [162089]
    Other proteins in same PDB: d1xmzb2
    automated match to d1xqma_
    complexed with bme, nh2

Details for d1xmza_

PDB Entry: 1xmz (more details), 1.38 Å

PDB Description: Crystal structure of the dark state of kindling fluorescent protein kfp from anemonia sulcata
PDB Compounds: (A:) GFP-like chromoprotein FP595

SCOPe Domain Sequences for d1xmza_:

Sequence, based on SEQRES records: (download)

>d1xmza_ d.22.1.1 (A:) automated matches {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
flkktmpfkttiegtvnghyfkctgkgegnpfegtqemkievieggplpfafhilstscm
ygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvkilg
nnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrskkp
asalkmpgfhfedhrieimeevekgkcykqyeaavgrycdaapsklghn

Sequence, based on observed residues (ATOM records): (download)

>d1xmza_ d.22.1.1 (A:) automated matches {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
flkktmpfkttiegtvnghyfkctgkgegnpfegtqemkievieggplpfafhilstscm
ygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvkilg
nnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrskkp
asalkmpgfhfedhrieimeevgkcykqyeaavgrycdaapsklghn

SCOPe Domain Coordinates for d1xmza_:

Click to download the PDB-style file with coordinates for d1xmza_.
(The format of our PDB-style files is described here.)

Timeline for d1xmza_: