Lineage for d1xm2d_ (1xm2 D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2454573Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 protein domains)
  6. 2454631Protein automated matches [190696] (4 species)
    not a true protein
  7. 2454632Species Human (Homo sapiens) [TaxId:9606] [188122] (15 PDB entries)
  8. 2454653Domain d1xm2d_: 1xm2 D: [162086]
    automated match to d1rxda_
    complexed with so4

Details for d1xm2d_

PDB Entry: 1xm2 (more details), 2.7 Å

PDB Description: Crystal structure of Human PRL-1
PDB Compounds: (D:) tyrosine phosphatase

SCOPe Domain Sequences for d1xm2d_:

Sequence, based on SEQRES records: (download)

>d1xm2d_ c.45.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld
wpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkye
davqfirqkrrgafnskqllylekyrpkm

Sequence, based on observed residues (ATOM records): (download)

>d1xm2d_ c.45.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvevtyknmrflithnpatlnkfieelkkygvttivrvcedttlvekegihvldwpfdd
gappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkyedavqf
irqkrrgafnskqllylekyrpkm

SCOPe Domain Coordinates for d1xm2d_:

Click to download the PDB-style file with coordinates for d1xm2d_.
(The format of our PDB-style files is described here.)

Timeline for d1xm2d_: