SCOPe 2.01: Domain d1xm2c_: 1xm2 C:

Lineage for d1xm2c_ (1xm2 C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein automated matches [190696] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188122] (5 PDB entries)

8. Domain d1xm2c_: 1xm2 C: [162085]
   automated match to d1rxda_
   complexed with so4

Details for d1xm2c_

PDB Entry: 1xm2, 2.7 Å

PDB Description: crystal structure of human prl-1

PDB Compounds: (C:) tyrosine phosphatase

SCOPe Domain Sequences for d1xm2c_:

Sequence; same for both SEQRES and ATOM records:

>d1xm2c_ c.45.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld
wpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkye
davqfirqkrrgafnskqllylekyrpkm

Timeline for d1xm2c_:

• d1xm2c_ is new in SCOPe 2.01-stable
  
• d1xm2c_ appears in SCOPe 2.02
  
• d1xm2c_ appears in the current release, SCOPe 2.08