| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
| Protein automated matches [190696] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188122] (16 PDB entries) |
| Domain d1xm2c_: 1xm2 C: [162085] automated match to d1rxda_ complexed with so4 |
PDB Entry: 1xm2 (more details), 2.7 Å
SCOPe Domain Sequences for d1xm2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xm2c_ c.45.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld
wpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkye
davqfirqkrrgafnskqllylekyrpkm
Timeline for d1xm2c_: