Lineage for d1xkdb_ (1xkd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138965Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2138966Protein automated matches [190603] (16 species)
    not a true protein
  7. 2138967Species Aeropyrum pernix [TaxId:272557] [188121] (1 PDB entry)
  8. 2138969Domain d1xkdb_: 1xkd B: [162082]
    automated match to d1hqsa_
    complexed with ca, ict, nap

Details for d1xkdb_

PDB Entry: 1xkd (more details), 2.3 Å

PDB Description: Ternary complex of Isocitrate dehydrogenase from the hyperthermophile Aeropyrum pernix
PDB Compounds: (B:) isocitrate dehydrogenase

SCOPe Domain Sequences for d1xkdb_:

Sequence, based on SEQRES records: (download)

>d1xkdb_ c.77.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]}
sppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkv
yggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrslnvai
rqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrfl
aeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafm
rwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqviva
pnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsas
lligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayidead
l

Sequence, based on observed residues (ATOM records): (download)

>d1xkdb_ c.77.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]}
sppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkv
gsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrslnvairq
aldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrflae
efgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafmrw
ayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqvivapn
lngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsasll
igefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayideadl

SCOPe Domain Coordinates for d1xkdb_:

Click to download the PDB-style file with coordinates for d1xkdb_.
(The format of our PDB-style files is described here.)

Timeline for d1xkdb_: